PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G046400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 445aa    MW: 50539.7 Da    PI: 6.7047
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G046400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.7e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+  ++++G g+W++ +++ g++R++k+c++rw +yl
  Phvul.003G046400.1 14 KGPWTPEEDQKLIAFIEKHGHGSWRALPAKAGLRRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding513.3e-1667112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+++ eE++ +++++++lG++ W++Ia+++  +Rt++++k++w+++l
  Phvul.003G046400.1  67 RGKFSLEEEQTIIQLHALLGNR-WSAIASHLA-KRTDNEIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.486961IPR017930Myb domain
SuperFamilySSF466892.64E-3011108IPR009057Homeodomain-like
SMARTSM007172.5E-151363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
CDDcd001672.80E-111661No hitNo description
PROSITE profilePS5129425.6562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-2665116IPR009057Homeodomain-like
SMARTSM007177.7E-1766114IPR001005SANT/Myb domain
PfamPF002492.3E-1567112IPR001005SANT/Myb domain
CDDcd001673.24E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MGRSPCCEKT GLKKGPWTPE EDQKLIAFIE KHGHGSWRAL PAKAGLRRCG KSCRLRWTNY  60
LRPDIKRGKF SLEEEQTIIQ LHALLGNRWS AIASHLAKRT DNEIKNYWNT HLKKRLDKMG  120
IDPTTHKPKI DSQIHFKDGS NLSHMAQWES ARLEAEARLV RESKLQEQHN LVLTSSSPPP  180
PQQQPRLILH KITPQHHHHQ QQQPSLPPCL DVLKAWQSSC SDNNNNKHSS LHDRKKAMHV  240
HSMYAMMLAT DDLESPTSTL CFPESLQIHN NNDNNNSNVM VSTNQVRLMN ENYLLPPTGV  300
EEFMSKSLGT CGEGATVKED ACCGGDGENS ETWRYFTKHG TDHDEEVAET EKRIMQLTMP  360
CLEDEDIMVA VDALRGGGYY GNNNDDINND VVAFTPLSRN VNMVVGFNND LQDFDSNQDL  420
ATTENLEVNF RENKDYWNSM LGYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153567.10.0hypothetical protein PHAVU_003G0464000g, partial
TrEMBLV7C9G60.0V7C9G6_PHAVU; Uncharacterized protein (Fragment)
TrEMBLA0A0L9UT730.0A0A0L9UT73_PHAAN; Uncharacterized protein
STRINGGLYMA02G12266.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-97myb domain protein 16